DPCstruct | MC20411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PCK3 | 9-89 | TRLGSSKEMAKQVAFSGILSNAPEYNPDFYNWNKVRVRYCDGSSFTGNKEEVDPSTNVHYRGARVWQAVIEDLLAKGMNKA |
| A0A287MTP6 | 3-85 | RRAEFVGILSDDELQNPDFYNWNKVKVRYCDGASFSGNVEEEFQDGTQFFFRGQRIWDAVMSELLSKGLSHAKEVALLQNRST |
| A0A452XN05 | 23-104 | None |
| A0A0M0LR79 | 166-244 | None |
| A0A6P4C0M5 | 9-73 | None |
| A0A2C9VS49 | 39-113 | None |
| A0A287FMC8 | 19-96 | None |
| A0A287SGU5 | 9-73 | None |
| A0A7J7HFJ9 | 24-104 | None |
| A0A0E0N645 | 90-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.