DPCstruct | MC20410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 15.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0489 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1P7D0 | 1-106 | MRPRKLILHHKKRRRLLPYAPSEETTHRLKQMRSLASSLTSLNMEYSDDLTYSIDMAPRSANLSMHEKGGMQVLSKEDTETLAYRRA… |
| A0A446QHA5 | 1-137 | MHKKKRRLLPFVPTADRVRRLEQMASAATALTSSKMEFSNELTYVPSMAPISANQAKLEEGGMQVLSKEDKETIELCRSMLKRGECP… |
| A0A059B9D5 | 202-311 | None |
| A0A3L6PMY2 | 164-267 | None |
| G7I3E9 | 322-452 | None |
| A0A6V7QXS0 | 726-871 | None |
| A0A1E5UU68 | 2-135 | None |
| M8D415 | 69-174 | None |
| A0A6S7NC50 | 81-209 | None |
| A0A078JBI1 | 119-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.