DPCstruct | MC2041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 312 ± 54 aa |
| Standard deviation of domain lengths | 53.70 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672LI48 | 27-329 | DTLNNLVAIDRSGLPIRYFLNPSTFPDLPQPTVNKMASSVRQAAEQYYKVNTIPGCVNPDSKNFNFQANVDDASCEGPVTNLSFGGI… |
| A0A818ZZ34 | 365-672 | ITRKVVNSKGGKVCLSGGSMETWQASIETKPVIVRRAIENITFFIQSDKIPELSEIALARVREKINEAIETYIQMNVHNGCMNRTSP… |
| A0A3Q2PNE0 | 123-425 | None |
| A0A7J6CRJ9 | 191-481 | None |
| A0A815HJ07 | 4-300 | None |
| A0A183WQK2 | 1-292 | None |
| K1PZW3 | 2-302 | None |
| A0A3M0JAS4 | 28-388 | None |
| A0A815NLK6 | 51-401 | None |
| A0A183KE68 | 1-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.