DPCstruct | MC20409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 121 ± 29 aa |
| Standard deviation of domain lengths | 29.20 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5WH75 | 10-88 | DDSQSRGRLLVYFPMETVDCGAAEASSHGFFDLHDTPPWDTWFWYSDGAILAWVPEGFITRAQAGIDANPVDCIHWATP |
| A0A239ARG3 | 15-132 | ALHLALQQRTQLVGQPTAPMVDLSRWGRILCFSTLLTTHDGITLAESNCFLDESDVPPIDTWFYLENNFLDAERPTLFCWIPKPFEP… |
| A0A7C7ZJN2 | 38-161 | None |
| A0A511N5G9 | 25-143 | None |
| A0A2W5BVM8 | 14-108 | None |
| A0A1W1UKQ1 | 14-111 | None |
| A0A0W8EE69 | 1-154 | None |
| A0A3S0D3R8 | 1-211 | None |
| A0A7Y4HH03 | 12-105 | None |
| A0A0R3LU42 | 98-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.