DPCstruct | MC20408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P1G2U9 | 3-88 | VNKSFAYAIENDDGKTFDNISSADVIILGPSRSGKTPLCYYLASLGLNAINIPLVPEVDQFDMIKDLDRSKMIGLIQDEEYLSKIR |
| A0A448QX37 | 12-96 | HNVEKYDERMEAVNFALNHDDGVSDKDLQQADVILLGVSRSGKTPTCLYLALQYGIRAANYPLTPEDLDSTELPRMVNLIVINYT |
| Q1NJK8 | 6-103 | None |
| A0A3M0BWP4 | 111-212 | None |
| A0A447MTI6 | 3-107 | None |
| A0A496K0D7 | 10-106 | None |
| A0A090S0Q3 | 107-210 | None |
| X0RTL1 | 2-75 | None |
| A0A7S1T3Y3 | 13-115 | None |
| A0A7S1NKN4 | 168-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.