DPCstruct | MC20406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0Y5N9 | 51-117 | VQQQCDCGLHVVTDGEFRRAWWHFDFFDGLQGVERYDAEQGIQFNGVQTKAHGVRVTGKLAFGDHPM |
| A0A660J741 | 49-125 | IAKQKAAGLKVVSDGEFRRSYWHLDFFWGLAGVEHTLMEQGYLFQGEETRADSARLVGKVAFDPSHPVFDEYRFAAQ |
| A0A377ZTF5 | 1-63 | None |
| A0A091C7B2 | 78-157 | None |
| A0A1E7YZ69 | 1-70 | None |
| A0A377INH3 | 59-123 | None |
| A0A387BMT9 | 364-435 | None |
| A0A644URN4 | 2-60 | None |
| F8DKP4 | 55-130 | None |
| A0A857HNI6 | 63-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.