DPCstruct | MC20405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8PWA8 | 50-110 | SRTFECFDHARDGVENFVTISGGKTTSARAMAEKVSDVICNKLGIDVPCRTREVVLASYRE |
| A0A800CI86 | 151-231 | RDVTRAYTLLDHETRDGVTGFITITGGKWTTFRQMAEVTVNRVCEKLGVERPCSTADTPVPNPFGHTGRYHYLGQRLAEVE |
| A0A7V3GU20 | 95-172 | None |
| A0A2X1RH57 | 152-237 | None |
| A0A376U6H3 | 29-100 | None |
| A0A7X9HEM2 | 184-268 | None |
| A0A662GI20 | 26-110 | None |
| A0A0A2W1X2 | 319-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.