DPCstruct | MC20403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5GX17 | 28-92 | WLEAGDIEEGLQAAASIGDDRLQRNAGQQVNPEGFTHGTSKQRSYWLTVGIKYGDMQRCDTFAAA |
| A0A448QR83 | 6-72 | KFKRREIRSRDVEEAFIASQAVGDDRLQKQAQGYIVPDSFTHGSSAERLAWFRKGLQSGNPAVCDTF |
| A0A853QZN9 | 164-218 | None |
| A0A661FGZ9 | 239-298 | None |
| F0GZ40 | 9-68 | None |
| A0A538I4D2 | 78-144 | None |
| A0A3P5XMI2 | 3-52 | None |
| A0A645DLG9 | 30-88 | None |
| A0A518L9B7 | 73-135 | None |
| A0A6M1CR12 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.