DPCstruct | MC20402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 62.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1WLX8 | 77-145 | AMLLKDALKPNMVQTLENTPAFIHGGPFANIAHGCNSILATKLALATSDYAVTEAGFGADLGAEKFMDI |
| A0A448QQ20 | 7-71 | DAIKPNLVQTIEGSPAFIHGGPFANIAHGCNSVTATRLALHLGDYAVTEAGFGADLGAENSVILN |
| A0A653DCT0 | 47-119 | None |
| A0A653DE60 | 53-125 | None |
| A0A091EAY1 | 12-90 | None |
| A0A7J6SQD3 | 15-88 | None |
| A0A7C1WNN4 | 93-161 | None |
| A0A812LKM4 | 126-203 | None |
| A0A0D8XDL0 | 141-211 | None |
| A0A075FGY6 | 154-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.