DPCstruct | MC2040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 144 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821EK99 | 12-145 | RCPLIRINVFGIHESHQIPNIPCDRSSNDVFLNQHLQWYHNFDSGSARKLVRAIFNNTSPHQNLFSINDPIVKRNIAVEGYKCKCPL… |
| A0A818ZA70 | 10-151 | TTVIGQCPLTFDGAYGLTEAKHSIKFCEHTQTRPIRLYNHFIGKHRLKPYYARRLIRAIINNKEPKITKLFDENENVVYNLCKVSCP… |
| A0A815M2R9 | 104-249 | None |
| A0A817I865 | 73-227 | None |
| A0A819CWM5 | 158-297 | None |
| A0A818AQH7 | 58-199 | None |
| A0A814Y238 | 393-537 | None |
| A0A818KSH2 | 6-140 | None |
| A0A817N053 | 138-277 | None |
| A0A816UJG2 | 302-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.