DPCstruct | MC204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 148 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 66.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 56.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484N159 | 559-715 | KLLMTVIPLQILANVASVVIGETGPFIKDWVTWNQVFLIVDIICCCAIIFPIVWSIRSLRETSKTDGKAARNLAKLTLFRQFYIVVI… |
| A0A812UH70 | 12-153 | IVVAVLSLQVINNIAMVIIEETSPGSVGWMTWRDLLHLVDIACCIAILYPIFWSINHFRQAAEADGKARDNLQKLQLFRQFYVMVLC… |
| A0A835J020 | 99-241 | None |
| D7MYG8 | 153-291 | None |
| A0A0D3CYW8 | 527-687 | None |
| A0A6N2JXV4 | 242-402 | None |
| B3RNG2 | 78-220 | None |
| A0A0T6B3P9 | 128-273 | None |
| A0A212D1A7 | 290-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.