DPCstruct | MC20395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 189 ± 39 aa |
| Standard deviation of domain lengths | 39.02 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.85 |
| Pfam Score | 83.29 |
| Assigned Pfam label(s) | CL0123- CL0383 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661WSY3 | 19-220 | LLAVREAGNCPDHPALREARQGLEVELRARFKDLDRKGLRALAVFSAYDSFYHSFRKTYHVQLQLESVLFKGKPIIAPSALVGAMFM… |
| A0A3S4ZVM1 | 188-388 | KAPVISAVPATIADKVAVELQAPEACPRYLARVVKNVNVKAASPLWLQEKLRRCGIRSIDPIVDITNLSLLELGQPMHAFDASKIDG… |
| A0A2R6CSQ8 | 525-735 | None |
| A0A379URE4 | 15-173 | None |
| K2D7H2 | 328-510 | None |
| A0A1V5R1N1 | 17-227 | None |
| A0A354VHM5 | 127-331 | None |
| A0A256ZJW9 | 60-249 | None |
| A0A819UU86 | 138-398 | None |
| T0CTL9 | 67-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.