DPCstruct | MC20394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.55 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 95.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4VHE3 | 75-172 | LNSGEWNVRDFIVKSGVEVICTTDDPVDSLEYHGKIKADTDFNVKVLPSYRPDKGLEINREGFMDWVTKLAEASGIKIDSYHALLEA… |
| A0A6M1CPZ9 | 2-88 | MQQMNVHMVGTTDDPADSLEYHRQIAQDDSFDIEVRPSWRPDRAFKIELDGFTDYIAKLGQSADVDIRRFSDLLTALERRLAHFAQH |
| W6AKE2 | 1-103 | None |
| A0A377M1T6 | 2-86 | None |
| A9WVB0 | 1-99 | None |
| U2YPV8 | 27-125 | None |
| A0A2Z5Z6T8 | 61-157 | None |
| A0A351APA7 | 146-243 | None |
| W4U5W5 | 80-177 | None |
| V9G4S6 | 136-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.