DPCstruct | MC20393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 65 ± 1 aa |
| Standard deviation of domain lengths | 1.20 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 67.24 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF10150- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A149TP12 | 186-250 | VQVVKEERGNKGAALTTYVSLAGRYCVLMPNALRGGGVSRKITSDTDRRRLRDLIAELNLPKSMA |
| A0A2H0QYW8 | 167-231 | VQVEKEERGNKGASLTTFISLAGRYCVLMPNSLRRGGVSRRIENREDRKRLKSVLKNLNIPVEKG |
| A0A2A4XXG1 | 114-180 | None |
| A0A6M1SY66 | 173-239 | None |
| A0A2G6EWT1 | 104-167 | None |
| A0A1G5DT69 | 106-169 | None |
| A0A2Z3G2J8 | 261-325 | None |
| A0A2E9B4J9 | 148-212 | None |
| A0A357MQP1 | 104-167 | None |
| A0A2A3JWB9 | 258-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.