DPCstruct | MC20391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10946 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4XUB9 | 2-110 | AHFKRLVYASKNHYEILASYPEDAGAALVGMQLSTRSPMGAIVYETGGIFIDHGWLRILGSGNEKLPRGLFDWNFGKTFKQSGEQPS… |
| A0A2V0QZW2 | 86-199 | LPLVEEMLADASVNYQLLPSSAESSRVLTRLQVTTRSTLGTIAYHTGGLLIDHGWLRVLGSGHPLLPRNLADWNEGRADGCLLVADD… |
| A0A0M8W100 | 5-117 | None |
| A0A2M9L4F7 | 10-127 | None |
| A0A066YL94 | 1-126 | None |
| A0A8B3U6J8 | 14-115 | None |
| A0A413R8P5 | 5-118 | None |
| S3Y4A2 | 18-135 | None |
| A0A1J0GGY9 | 10-97 | None |
| A0A2W5VL33 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.