DPCstruct | MC2039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 159 ± 23 aa |
| Standard deviation of domain lengths | 23.16 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0ILH7 | 10-147 | EVKSLYNGILADSASSINLKIQILKNLQTYLQEEDTRMQEADREWKKLSKQEDLKEMGDISSGMSSSIMQLYLKQVLEAFFHTQSSV… |
| A0A818YNK9 | 1-218 | MIELQIRQIYHTYLLDRRPEAAQLRCQVLINLEEYFRDCIRRMAEQDVDYLHITSTVNSTTTTTTTTTTTHDDENSNDASGPTGASL… |
| A0A183Q939 | 129-287 | None |
| A0A2V2X0R3 | 106-277 | None |
| A0A3P7LKA0 | 252-379 | None |
| A0A0B1SYQ9 | 2-126 | None |
| Q54RK7 | 1598-1782 | None |
| A0A816BDB2 | 348-506 | None |
| A0A484AT60 | 211-372 | None |
| A0A6J5WUA7 | 169-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.