DPCstruct | MC20389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2U5P2 | 34-116 | QKHGIPLSSIDTVGFHGETIWLLSIPEEGQIKSALSMAEGCFISSRTGITTVTDFRVSDQAAGRQGAPLIGFFDSLLLHHPTK |
| A0A3S4WCE8 | 12-88 | AEHQLSASDIQAIGCHGQTVWHSPNGKVPFTMQIGDMNLVAAHTGITTIADFRRKDMAVGGQGAPLVPAFHEGILPR |
| A0A847VER8 | 2-82 | None |
| A0A6P4I472 | 97-162 | None |
| A0A8B6JFG8 | 1-77 | None |
| A0A661F0D4 | 1-72 | None |
| A0A354VMU7 | 76-160 | None |
| A0A2V7S692 | 64-140 | None |
| A0A532CZD2 | 80-167 | None |
| A0A1L9TK69 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.