DPCstruct | MC20385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 2.54 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 44.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0LZ99 | 41-102 | TRRVNALVTDLNEKEQHGSMWKCDIQQNADKQFEPIIRVRTHGVDTDYPLEHEFVTGPEYRR |
| A0A3S4W0D5 | 1-67 | MTAWNEQFVAKLMEKETGGSFYRSEVFFNTERQVYEPEIVVTTHGMDTTYRLDFNFISSNEYAKLPH |
| A0A2G2PBU4 | 59-120 | None |
| A0A6M1HWA5 | 118-178 | None |
| A0A381G9J8 | 35-102 | None |
| A0A418H122 | 462-523 | None |
| A0A7Y0WZ79 | 331-393 | None |
| A0A6D0EKJ4 | 101-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.