DPCstruct | MC20383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 126 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.42 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0193- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1D945 | 82-200 | LAFFTTVGLGASFALLKKGGKLLIVYWLLCGIISILQNTIGITISKTIGLEAPYALLSSAISMVGGHGAALAYGNSFAKIGYESAPL… |
| A0A3S4VXB8 | 1-115 | MLAFFASVGLSADFSRLKQGGLPLVVFLIIVGVFIIIQNAVGVGLATALGLDPLVGLITGSITLTGGHGTGAAWAKIFSEQYGITGV… |
| A0A3G7U4V9 | 72-185 | None |
| A0A240EEQ3 | 74-187 | None |
| A0A090RUL7 | 1-146 | None |
| A0A377TL97 | 66-197 | None |
| A0A1C6MB13 | 69-227 | None |
| R6ACV8 | 75-191 | None |
| A0A7J6ZA53 | 326-461 | None |
| W1EX18 | 11-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.