DPCstruct | MC20381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 66 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7GQG3 | 5-58 | DYRQFVNYYNHERYHESLKNLSPADVFYGRGQEILEQREKIKLPTLAQRRKMHY |
| X0ZLX8 | 1-72 | MKNLILLDHYYSPSELEERIREWIDYYNNQRYHEAIDNVTPGDRFYGKDMEILEQRQRTKTETMYQRRKIYR |
| A0A1H3JSD8 | 5-79 | None |
| A0A846P489 | 1-56 | None |
| U2IFN0 | 158-216 | None |
| A0A238LJC4 | 54-128 | None |
| A0A3B0TX47 | 27-90 | None |
| A0A3M1C4R0 | 21-107 | None |
| A0A1H8G674 | 220-286 | None |
| A0A3C0S9K9 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.