DPCstruct | MC2038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 375 ± 39 aa |
| Standard deviation of domain lengths | 39.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A336M010 | 2-423 | LDHVLFNPSLWIFTPAVVQIRLYCYLATEFLNDTQIYSSIRRVSTVLQTIHTLKYYYWIVTPSCSSGISAKGIGTYRPSQKDIITIR… |
| A0A0M3KHH5 | 3-323 | LTTRLLAERPAVMVPAFDRNKGLAVVFKLLNSTNELIRVPALKIFGFFLCRSTLKRKNDSVGNLNLFTLLTDRLLLNASYLSLATYN… |
| A0A817QFF4 | 53-429 | None |
| Q19317 | 687-1090 | None |
| A0A0K0EAS9 | 828-1134 | None |
| A0A453NEY0 | 127-495 | None |
| A0A835QR68 | 327-738 | None |
| A0A1S4DKI2 | 2-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.