DPCstruct | MC20376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 188 ± 24 aa |
| Standard deviation of domain lengths | 24.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2AS19 | 172-322 | QTAASQVVTTAITNPAVPRNITATAGGGTAGDIKAIQVVVAGTNYLDQAITETLPAFTADTPGSVVGSKAFKTVTSITIPAHDGTGA… |
| X0Z0Q9 | 1-177 | MAGTSIIHFQDVRAEDDDYIHAAISGTGAALEVTTGITNPDVARNTSITTSNDNSPFGIVEITGVNAEGENTSENIAIRAGRIAYGD… |
| A0A0F9W7Y5 | 48-241 | None |
| A0A843GLW8 | 22-191 | None |
| A0A5C7QHL0 | 2-248 | None |
| A0A6M3IGH0 | 46-235 | None |
| A0A6M3JR94 | 25-223 | None |
| A0A7Y5KX06 | 163-335 | None |
| A0A7Y5KT69 | 1-186 | None |
| A0A1V5FEI0 | 38-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.