DPCstruct | MC20372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 66 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 58.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388KW70 | 10-75 | VPALLGSCVISGVFWHLTRNSKVFGGETPRTLTKEWEQATDKMMSSMPREGGPNVILNPVKRQNYR |
| W9RTH4 | 73-129 | YIPLTIPPLEGTTPHTVSNKEWWEETDKKLQAWPRTAGPPVVMNPISRQNFIVKSHT |
| A0A1Y1I4U2 | 15-89 | None |
| A0A2I0AB20 | 16-69 | None |
| A0A251VTM2 | 9-56 | None |
| A0A3S3P4K9 | 53-114 | None |
| A0A7J6FJT1 | 87-150 | None |
| A0A3L6PBD5 | 110-179 | None |
| A0A4S4E830 | 3-59 | None |
| A0A7J7MUP4 | 31-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.