DPCstruct | MC20371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 3.95 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01988 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378U6S0 | 6-78 | SRLNWLRAGVLGANDGIVSTAGIVVGVAAATAEHAPILTAGVAGLAAGAVSMALGEYVSVSTQRDTERALLHK |
| W9RL05 | 38-108 | DYSVRAQWLRAAVLGANDGLVSIASIIMGIGAVKRDIKDMLLAGFTGLVAGVCSMAIGEYVSVHTQLDIEI |
| A0A7Y0IRE2 | 14-87 | None |
| W4TZP2 | 40-109 | None |
| M4DIV4 | 23-93 | None |
| A0A2P7P098 | 1-78 | None |
| A0A198GHK9 | 9-75 | None |
| K0ZYH8 | 2-82 | None |
| A0A3S4Y7B7 | 12-82 | None |
| W4UEC5 | 40-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.