DPCstruct | MC2037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 26 aa |
| Standard deviation of domain lengths | 25.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9KRL1 | 281-428 | LLANQSLLFTLVLTNHCTCDKSVHNPYRQALFSFTDSQESGAINLTHSASTFKLDMSKVYHVLCQTLHDDQTTLLLYLLLHQNPNMK… |
| A0A818Y5R5 | 358-494 | NHFTNDIHRNPYRLALLHFTDTQGKKINPTNLPDSEPLPWFSIDYHRLYDILCQTVHTDQSTLLLYLLLHRNQHFKAYVISRTNIDQ… |
| A0A816GAX8 | 38-199 | None |
| A0A6F9A491 | 6-115 | None |
| A0A7S1GDD9 | 83-218 | None |
| A0A2P2MPU7 | 119-300 | None |
| N1R3P1 | 12-148 | None |
| W6UIA6 | 343-482 | None |
| A0A822G256 | 1-156 | None |
| A0A426XLW1 | 89-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.