DPCstruct | MC20369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 59.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2YYV2 | 139-247 | EEYRELLADMCQQKLAPNLPYVKSLFLGWFEPLRDQIIAEQELVGERGARASHARYFNMLPADMMAVITMHKLMGLLMTGSGDGSVR… |
| A0A3N7G0J9 | 1-111 | MCEHKLAPNLPYMKSLFLGWFEPFTDAIAKEQELIRTGKSRQGYASYFDLLPADKMSVIAMHQLAAMVVTGGEHGCARVVTAACMIG… |
| A0A4Y7LAV0 | 66-179 | None |
| A0A0B2PZ95 | 72-192 | None |
| A0A3N7I0S3 | 44-167 | None |
| A0A1R3HZN3 | 123-231 | None |
| A0A7J7NNN6 | 262-360 | None |
| A0A540NHU2 | 12-111 | None |
| A0A444FTS2 | 734-836 | None |
| A0A438CX98 | 21-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.