DPCstruct | MC20367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.13 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9RDW1 | 1-78 | MDSYEASRTIFSRIQSLEPENATKIMGYLLIQDNGEKEMIRLAFGLESLLHNLIIKAKTHLAILPKSSSSSSFFFFSS |
| A0A2G9HJC3 | 1-72 | MDYLESTKVVFQRIQKHDPENVSRIIGYLLLKGYGELEMIRLAFGPEYVIQTLIEQVKREMNSSPKPIISSN |
| A0A2I0JQH2 | 1-93 | None |
| A0A445ML54 | 1-91 | None |
| A0A314YKW8 | 1-78 | None |
| A0A1E5ULS2 | 1-79 | None |
| A0A6A2XN24 | 1-78 | None |
| A0A0A9BHN5 | 1-76 | None |
| A0A287H7G5 | 12-89 | None |
| A0A835M2Q4 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.