DPCstruct | MC20365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IPF8 | 71-156 | HKEKLIEKYGGEEYLNAPPKELLLAQTEHYVEYSRKGTVIKGEERPAVRSRYEEDKYINNHTSVWGSYWHAGQWGYGCCHSFLRNS |
| W9RB90 | 5-88 | KFTILEKYGNTASGQEIPRELLLGQTEKEVEYDRAGGIIKGQEMALPRSKYEEVLVNNHTSVWGSYWKGHQWGYKCCKQMIQKD |
| L0PF51 | 118-197 | None |
| A0A026WWF6 | 216-330 | None |
| A0A058Z8W3 | 155-264 | None |
| A0A835IYK1 | 1-97 | None |
| H2YSG7 | 195-280 | None |
| A0A817U1G0 | 381-467 | None |
| A0A3N6RG06 | 61-142 | None |
| A0A1I8A9K1 | 79-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.