DPCstruct | MC20362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 89 ± 14 aa |
| Standard deviation of domain lengths | 14.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4V4Y8 | 40-141 | ERIIAEVNDEGQRLSAEAKAAVEASTAEFDAATRDREARASRVPVELLAMYTTLATRSAGAALFRRQTCEGCRMMLSGTDLQDLRQM… |
| A0A4Y7X7V4 | 16-109 | LSGLNKEKAISEKELEGLISKRNKLSKGISKEIYDKYIKLLSKKGGIAVVRAVSEICCGCNMSIPPQLFVEVMKNDRILTCPQCGRI… |
| A0A848XS05 | 2-81 | None |
| A0A2T6E0W8 | 17-101 | None |
| A0A3C2AF25 | 3-76 | None |
| A0A661AUP2 | 33-124 | None |
| A0A7V1KMI2 | 2-63 | None |
| R7LB69 | 5-108 | None |
| A0A3C0RRX4 | 164-243 | None |
| A0A6J6RVV5 | 49-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.