DPCstruct | MC20361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 154 ± 16 aa |
| Standard deviation of domain lengths | 16.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7X7C1 | 11-174 | KQLIISAALLVAILATGTFGYMAVEGWGDVEEGVTVKEQVDEITGLSHRLIVDFPTHLDLRPRISIKDEHGKATLKLPNGVPARYML… |
| A0A081D8Y6 | 233-392 | TTFQVETDEQTGYEEKVITDSRDKKLIPTLHIVDSKGDTQISYNLPVGSHLMVNDSEKIKVGKVLVKIPRKSAKAGDITGGLPRVTE… |
| A0A813TXS5 | 211-339 | None |
| A0A838GXJ2 | 763-936 | None |
| A0A2E5LD10 | 809-947 | None |
| A0A3D1L361 | 2-182 | None |
| A0A7T0BRH4 | 1-156 | None |
| A0A4E0QSV8 | 3-135 | None |
| A0A7Y7CRY0 | 83-249 | None |
| A0A069DAB0 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.