DPCstruct | MC20360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9QMR1 | 7-100 | QYFANASNFWKSRSKKQKTIFLSSLALIVLLASVITFFATRTKMEPLYSNLSPEEVGSIKQDLDSRGVKYEITDGGTTIMVPSDSVD… |
| A0A4Y7X6F4 | 2-93 | ADIKLLVDKVKNWPDKKKAVMAGFLVLGLAAVIVLFAWSQKVPYQVLFSNLADEDAGKIVAKLKDLKVPYKVTQNSVMVPQDKVHEL… |
| A0A259S1A3 | 31-118 | None |
| A0A258TS93 | 6-107 | None |
| A0A562C8N4 | 13-110 | None |
| A0A6I6IGS8 | 217-316 | None |
| A0A2W5YT35 | 14-106 | None |
| A0A090S8G6 | 24-134 | None |
| A0A812FL93 | 38-135 | None |
| T0CRE1 | 10-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.