DPCstruct | MC2036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 59.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819P1S9 | 469-555 | ENKNLAKFRAFIAAAVANTIGDGKNTYLLLGPIGTGAFGNDVKRIGEVFCKALNSPMMGSKGSIRHAFEHIWFVSIHSCKNEEFKKI |
| A0A818XIJ3 | 3-87 | TRTLQKFRAIIASAVANTEGSGKNTYLLLGPIGTGAFGNSEKMIAQLFNEVLNGSLMGSIEAIRYAFEQIWFVSTDNLDIFRQIL |
| A0A819UAI5 | 572-673 | None |
| A0A819QAJ7 | 58-145 | None |
| A0A816E073 | 518-605 | None |
| A0A820T068 | 19-111 | None |
| A0A815SKN4 | 83-171 | None |
| A0A821Y8W5 | 1-76 | None |
| A0A814HYU6 | 2-95 | None |
| A0A815HGM9 | 688-774 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.