DPCstruct | MC20359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 170 ± 44 aa |
| Standard deviation of domain lengths | 43.84 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 94.64 |
| Assigned Pfam label(s) | PF05190- PF05188- PF05192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7X6E2 | 2-130 | SSFMFIDAVTIRNLELVGNLKDSTKNDTLLAILENNLTPMGTRFLRDALLRPLIDTTEINKRLDAVGTLVYDYTLRGNLRAKLKSIQ… |
| A0A3S4VRK6 | 2-115 | LDAATRRNLELTQNLAGGTENTLAAVLDKCVTPMGSRLLKRWIHQPIRDLEKLKKRQDIIDTLQKEQRIELLQPLLQNVGDMERILA… |
| A0A229Y375 | 906-1193 | None |
| A0A2V2VN48 | 170-345 | None |
| A0A0V0QKW8 | 230-319 | None |
| A0A2I9CJD1 | 297-415 | None |
| A0A7S3ZRR1 | 249-424 | None |
| A0A453E8P3 | 55-234 | None |
| A0A7X7XE34 | 261-423 | None |
| A0A0A8WP32 | 266-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.