DPCstruct | MC20357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 173 ± 38 aa |
| Standard deviation of domain lengths | 38.37 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0710 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2S5L9 | 181-404 | TVPSFRPVSLLTSIGPAGAVLVTAVVCGGIALAAARLERKRHGSIAPISSGASGGIALVRGPWPLLWGAVGLVVVNVATLLLAGRPW… |
| A0A4Y7X5M7 | 11-159 | EFSSKAKPKVGYVWYVSGVLLGLIAVAAWWASDHFGGKPRGLSFSGPTIEFFRWITQGDSPTWSVFMIIGMVLGSFGSARALKEFKI… |
| A0A521UFK4 | 140-340 | None |
| A0A1G7HDW9 | 30-244 | None |
| A0A7X7WSS2 | 109-259 | None |
| A0A1I9YT49 | 7-139 | None |
| A0A5C5YWR5 | 69-253 | None |
| A0A067BGN4 | 66-237 | None |
| A0A1G0ZBY2 | 5-167 | None |
| A0A2E0URN6 | 205-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.