DPCstruct | MC20356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 85 ± 14 aa |
| Standard deviation of domain lengths | 14.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7S884 | 69-152 | DPSCAYEVQDVAYGDEFAPALVWADAARMRIERIPSFVRGVVMKRVEDYARRRGRREVTVELLAEVRRALPIDFSKRQPFFVSD |
| A0A4Y7X3K2 | 1-80 | MIKELGVFDGKLKVPENPAETVRAAAGILQWEPEALKRLDKVPVFVRWMAKSSIEKHAREKGLTTITVALMEEARHLYGM |
| A0A523MPQ1 | 1-86 | None |
| A0A1Q7B2V7 | 7-82 | None |
| A0A3M1HV47 | 583-652 | None |
| A0A533Z712 | 106-163 | None |
| A0A2V7JT16 | 3-99 | None |
| A0A1F7QGB1 | 40-141 | None |
| A0A355F8W2 | 1-67 | None |
| A0A2V7JBA8 | 59-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.