DPCstruct | MC20355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 68 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10049 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662KTU5 | 1-58 | MIKTDYDPEFDTLYIFKKGERVKFSIELFGSFVMDISFDNKVVGLEILNASKVLNVSK |
| A0A4Y7WYX4 | 1-62 | MMIKIEYDEEGDILEIRFSESKIENSECLEETGMVVDYDENNYIVGVEILSFTKRVSRGKMA |
| A0A3D5DQG9 | 86-171 | None |
| X1RWH8 | 15-72 | None |
| A0A3A5HJZ0 | 34-90 | None |
| A0A7X1PDE0 | 2-62 | None |
| A0A1V1P4V8 | 1-108 | None |
| A0A7W3W620 | 1-74 | None |
| A0A7C1MD35 | 108-164 | None |
| A0A1Z3HPY7 | 53-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.