DPCstruct | MC20352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 447 ± 46 aa |
| Standard deviation of domain lengths | 45.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3EVK9 | 264-717 | LPLKESVSQYGITWTFEKPARVGQFINGDWYVVGPATVAAIEPKPLYGNEIPKHQLDHMDKERPEAQRVRNGFMLNPPAAMKVAYDS… |
| A0A3A0G0J4 | 1-441 | MQSGNTFTYVSKHSAQYNATFNFNCGGGPCTFGTYITGGVWIRDAGQGVNFTSMTPAVSPGRNGWRVNHSDPVNVPWDDRCAHGYFD… |
| A0A7C4BFQ2 | 45-467 | None |
| A0A847P2D8 | 49-500 | None |
| A0A2N9NH62 | 6-404 | None |
| A0A0C5W2D3 | 2-384 | None |
| A0A3D3DF03 | 2-444 | None |
| A0A2A5AP18 | 51-566 | None |
| A0A1H4CVE4 | 185-665 | None |
| A0A1G2YR71 | 19-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.