DPCstruct | MC20350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 85 ± 18 aa |
| Standard deviation of domain lengths | 17.85 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286EV18 | 5-59 | QLLASWLDTPTRQAIVTFIADITTTGDTFVPEPERVAVFDNHGTLWTEKPIPIQL |
| A0A0K1QC58 | 29-100 | RGGDALPSWNDGPSRRAILDFVRAVTARGSSTYVRPADRIAVFDNDGTLWSEMPIPVQAAFIVDRLRALAPS |
| A0A069PKB4 | 109-187 | None |
| A0A1G6BLW1 | 32-106 | None |
| A0A2T1D6J5 | 3-72 | None |
| A0A2T0JP18 | 1-76 | None |
| A0A0Q9DS63 | 26-102 | None |
| A0A2D7E6T4 | 9-74 | None |
| A0A517Y2B1 | 239-347 | None |
| A0A3S4HT82 | 16-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.