DPCstruct | MC2035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818URB0 | 1-97 | MSTIDHVAFAMPRNSAKVAIEWYENVLSMKRFTINQEDDPFQGFTVRVGSMGMRMFSSVYWKCSETGCGDAASKLKFVFAESLIDPN… |
| A0A4S2M6Z8 | 189-259 | DHIALACNTGESDSVIQWYKEVFDMKRVAANILDDPNDGFLVEYGHTGMKLKAASYTETLTDACTFVFVEP |
| A0A817NLW3 | 1-74 | None |
| A0A553N1V4 | 174-252 | None |
| A0A162T0K0 | 167-250 | None |
| A0A183WAP8 | 183-261 | None |
| A0A818ZJW9 | 1-84 | None |
| A0A1B8XV74 | 168-242 | None |
| A0A1B8XV59 | 88-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.