DPCstruct | MC20345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 273 ± 37 aa |
| Standard deviation of domain lengths | 36.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9ZDQ0 | 176-429 | DLNTNLKSSSSFYNLPYPIDLRLDAQGEPDLSAFPILDTPLLKPLKELASDRPGFPTTSAAYFRFNLPVSSQNLDRVIPARTTSPIL… |
| A0A0K1PXA0 | 5-314 | TAAVSLASASCGSDTETDGAAVEGDPACENLDESACMFPFPSDYFRKSGGPFGQAFHLDFGTALPVNSVNDIPMSPEPFKANDGYPI… |
| A0A1Z7ZYV2 | 33-299 | None |
| A0A5C8A9B9 | 392-709 | None |
| A0A7J9YNP5 | 187-500 | None |
| A0A086WLD6 | 13-272 | None |
| A0A7Z9G7U1 | 32-288 | None |
| A0A6N2D3F5 | 60-381 | None |
| F7YQU0 | 2-244 | None |
| A0A537XCE8 | 161-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.