DPCstruct | MC20344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 12.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7PJX3 | 5-103 | SGRLTVFFEEPFWIGVFERISEGKLSVCKVTFGAEPKDYEIYDFVLKNYYRLKFSSQQALKLQQEQLKTERKAVSREQREAEKQRQF… |
| A0A0K1PRJ4 | 1-139 | MGSFTVFFDGQFWVGLAVRHRDSNSRVPEVARVVFGPEPSDAELLEWTREQFQRLEYRAVDSTAPLERASAGNPKRRQREARRALEE… |
| C3DPU6 | 203-336 | None |
| A0A7X8W318 | 1-123 | None |
| A0A7W2EAW5 | 18-156 | None |
| A0A1C6GVV1 | 5-132 | None |
| A0A544YB71 | 70-204 | None |
| F5T9B5 | 5-124 | None |
| A0A413SFQ9 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.