DPCstruct | MC20342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 169 ± 21 aa |
| Standard deviation of domain lengths | 20.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565AW12 | 1-133 | MKVGDPLYGVLSESQVGLDPLTGRPRIVDEMLAEMRGYIINDDGVDRQVKAERVRASLKDLENDYFGQKTILILEPPPIISQLVDRG… |
| A0A3N6QJ01 | 1-163 | MDINDPLFSLVPYNLMGIDNLSGKPKIAEEVLDNMRIYIKSADGPEKMAREERVKKSLKELEDDSLGQKTFLRLEAPPIVSNFLDKG… |
| A0A6J0N186 | 17-183 | None |
| A0A6J0N8C6 | 97-238 | None |
| A0A6J0P786 | 68-247 | None |
| A0A3P6B0R7 | 1-195 | None |
| A0A6J0L245 | 54-252 | None |
| A0A3N6QG64 | 124-289 | None |
| Q9SK97 | 59-242 | None |
| A0A3N6RRF3 | 79-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.