DPCstruct | MC20340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 69.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XIL9 | 192-275 | KRSSYAPETGVRYDGVYRIEKCWRKIGVQGTYKVCRYLFVRCDNEPAPWTSDLHGDRPRPLPRIKELQGATDITERAGSPSWDY |
| A0A3N6PZ38 | 64-159 | HLRFLPSRKHHGDSESYKEKRSAYDGVYRIEKCWLKVGVQGSCKVYCYLFVRCDNKLAPWTNDEHGDRSRPLPKLEDAIYMFERNKT… |
| A0A0D6R549 | 393-474 | None |
| I0Z4A7 | 312-402 | None |
| A0A2U1N9R6 | 151-224 | None |
| Q681I0 | 346-420 | None |
| A0A7J9H9H2 | 7-91 | None |
| A0A816ITW5 | 23-115 | None |
| A0A251VTB7 | 1-91 | None |
| A0A1D6FWL1 | 192-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.