DPCstruct | MC2034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 212 ± 24 aa |
| Standard deviation of domain lengths | 24.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0DG21 | 107-289 | SSLKDTIQQAEYTLESLNREMFELARKRELDKTILSHLEKPTIPPPKRISSEYSSLKKLVPSLYQQIEFEDNTVRAKTYPVSISYES… |
| A0A1F6BYA8 | 16-215 | KKILCRIVRARRSFTRENEMSANTESEDDIKLQYLCFCENPLRSTDQILRDYEVLKAHPRVTGIAFHSPYVLMIGTDEIVVTENHKK… |
| A0A0F9UHQ8 | 29-249 | None |
| A0A1G2VL60 | 22-221 | None |
| A0A0G0ZXK4 | 9-215 | None |
| A0A7K4HKE0 | 91-308 | None |
| A0A662MDN9 | 1-252 | None |
| A0A3E0Q6Y0 | 1-266 | None |
| A0A1G2RRF5 | 161-369 | None |
| A0A0F8YTK5 | 6-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.