DPCstruct | MC20339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 146 ± 27 aa |
| Standard deviation of domain lengths | 27.03 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1NLC4 | 280-453 | GQTIAALLIAGARETGRVTEAIAESNPLSSDILALGVAAQAFVVSQLAAAWAAMEFTNNQEAEEQLLVIKEMCDSLLTALETAITAK… |
| A0A0I9W119 | 17-158 | NQAAIYTLIERAAVAEAARLATGRPLDTAGSTLPGLTYNNREEAVDTRDVLVAELDRQQLQASPERYRALAGLTTALVTDLNRRSAS… |
| A0A0J5GHP7 | 227-388 | None |
| A0A0H2LWZ9 | 61-220 | None |
| B3X4Q4 | 196-305 | None |
| A0A7W4IC42 | 384-533 | None |
| A0A0N1JDL9 | 308-460 | None |
| A0A7H4K6C5 | 351-523 | None |
| F7VHM0 | 17-172 | None |
| A0A109J4B5 | 72-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.