DPCstruct | MC20332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 73.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2BXB6 | 103-167 | FCTLNTHKVDMEKLLGGQIGLEDFIFAHIKGQKKEIEVYKGEDALGLTITDNGAGYAFIKRIREG |
| G1NAX2 | 1-65 | MFCTLNTHKVDMDKLLGAQIGLEDFIFAHIKGQRKEVEVLKSDDLLGLTVTDNGAGCPFIKVNLF |
| A0A1S3M0M2 | 10-77 | None |
| A0A7R8CYD5 | 327-407 | None |
| A0A3L8RXG2 | 376-443 | None |
| A0A4Z2EBI2 | 15-82 | None |
| A0A7M4F293 | 1-69 | None |
| A0A183MQZ6 | 1-74 | None |
| A0A384DRD8 | 1-76 | None |
| A0A402FJN6 | 185-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.