DPCstruct | MC2033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353X712 | 12-84 | GITINGAAKTIAVSGARTLQELYDYSQWWAAQSGNIQYDAPLSTADGVGFALASGWSMSVTGALTGTGTLATK |
| A0A1J4RQQ3 | 1-82 | MIKDDFKIDFKNKKISYNPKGSGEAYTVNALYSYLQNLFARAQNMKYQIPIMATSKTECFLINGWTIDENARKYLKEGFLVS |
| A0A350IDJ9 | 24-113 | None |
| A0A0G0XIX9 | 4-90 | None |
| A0A0G0BS03 | 529-609 | None |
| A0A5D0I4D8 | 19-117 | None |
| A0A0G0TA97 | 3-83 | None |
| A0A1G1CC75 | 3-85 | None |
| A0A660TJN1 | 5-95 | None |
| A0A1F6ANM4 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.