DPCstruct | MC20328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.44 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0003- PF04905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1JLJ1 | 35-164 | MTSQPTNESELQLYRVLQRANLLSYYDTFIGQGGDDVQQLCEAGEEEFLEIMALVGMASKPLHVRRLQKALQEWVNNPALFQTPLVP… |
| A0A803YS76 | 17-131 | PRTLGELQLYRVLQRANLLGYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWASNPGLFSQPVPAVPVS… |
| A0A194RDF7 | 2-125 | None |
| A0A6A4W2U9 | 1-131 | None |
| A0A132A9U3 | 123-270 | None |
| A0A5N5PCF4 | 41-177 | None |
| A0A672KCT0 | 1-118 | None |
| Q15742 | 28-152 | None |
| B4J1E9 | 127-244 | None |
| A0A087YE25 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.