DPCstruct | MC20326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 221 ± 29 aa |
| Standard deviation of domain lengths | 28.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4ARY5 | 29-262 | GGSGLLCSLEGKSLQDRENAIVEQILSGNVPSRMRIWCTIKLEAQCPDGRRRTAQLQVLPDCLAVGSDTDSIRVCLTPQSAQKVADA… |
| A0A2A5Y174 | 25-226 | SLVACKADNTQGVYNLDLNICNERYAHSEQYLVPISFRNGILCVYPDYHTESQIRTPLGLADAFLLVDRLGLRLPTPEVVDSIYSQA… |
| A0A1F9VBF4 | 3-262 | None |
| A0A150NYP6 | 85-284 | None |
| A0A2N1U8Q6 | 132-386 | None |
| A0A6I1JTF3 | 8-221 | None |
| A0A661PC71 | 33-253 | None |
| A0A5C7PV50 | 4-237 | None |
| A0A4R6WI48 | 357-570 | None |
| A0A2N2VU22 | 11-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.