DPCstruct | MC20325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 171 ± 23 aa |
| Standard deviation of domain lengths | 23.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1YYS9 | 313-500 | MSDQVAPFDYDLQVNEKYVTIYSPDASKNSFNGTTLQQSVSVLNTVPLDAYEGKAFQTYSFEYVPGPTGYIIWRINDKLVWRLDAGA… |
| A0A166MG70 | 12-177 | AVSALTNVSDSTYGGPEGGKDFGIFGFEYYGDQDNAANSYITWVSDGEPSYGMIGTAVGPDADTQIGQRLVPMEPMSIILNLGASQT… |
| A0A3F2RDK2 | 103-254 | None |
| A0A397F3F7 | 377-546 | None |
| K3X0H4 | 265-404 | None |
| A0A2P4YPA9 | 194-354 | None |
| A0A836ASS5 | 16-193 | None |
| V9DS61 | 37-196 | None |
| A0A0C3DAT5 | 87-261 | None |
| A0A3F2RX64 | 401-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.